General Information

  • ID:  hor006961
  • Uniprot ID:  P18510??27-177)
  • Protein name:  Interleukin-1 receptor antagonist protein
  • Gene name:  prl
  • Organism:  Homo sapiens
  • Family:  IL-1 family
  • Source:  Animal
  • Expression:  The intracellular form of IL1RN is predominantly expressed in epithelial cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005813 centrosome; GO:0005829 cytosol; GO:0070062 extracellular exosome; GO:0005615 extracellular space; GO:0005654 nucleoplasm; GO:0005886 plasma membrane
  • GO BP:  GO:0045353 interleukin-1 type II receptor antagonist activity; GO:0045352 interleukin-1 type I receptor antagonist activity; GO:0005149 interleukin-1 receptor binding; GO:0005151 interleukin-1 type II receptor binding; GO:0005150 interleukin-1 type I receptor binding; GO:0005125 cytokine activity; GO:0005152 interleukin-1 receptor antagonist activity
  • GO CC:  GO:0006953 acute-phase response; GO:0002437 inflammatory response to antigenic stimulus; GO:0006955 immune response; GO:0051384 response to glucocorticoid; GO:2000660 negative regulation of interleukin-1-mediated signaling pathway; GO:0034115 negative regulation of heterotypic cell-cell adhesion; GO:0006629 lipid metabolic process; GO:0030073 insulin secretion

Sequence Information

  • Sequence:  PSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
  • Length:  151
  • Propeptide:  MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
  • Signal peptide:  MEICRGLRSHLITLLLFLFHSETIC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA